DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG3088

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:217 Identity:50/217 - (23%)
Similarity:87/217 - (40%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VIGGYLTQNDLVLKSVRLGE----STTDCITSESRCPHLDVEVGQTTVHQG-FTSSGGTY----- 196
            |:|....|:::......:|:    ::..|:|..|   .:.:..|.|.:.|. ||.:.||.     
  Fly    43 VVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSS---GVTIYFGATRLSQAQFTVTVGTSEYVTG 104

  Fly   197 RNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN---LQISGWDPTKSSQTL------ITSTVK 252
            ...:||:|:. .|.::.::..:.|.......|...   ..:.||..|..|..|      :...:.
  Fly   105 NQHLALVRVP-RVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIM 168

  Fly   253 ERNPADCLNRYPSFRSASQV-CAGGQRKGDTCAGISGSPVMGIMGS---GVDEFVFLAGIASYGQ 313
            ..|  :|:..|.|...:.|: |........||.|.:|||::....|   |:..||     ||.| 
  Fly   169 SNN--ECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFV-----ASNG- 225

  Fly   314 QYCYSAGIPGVYTKIGHFSEWI 335
              | :.|:|..:.:|....:||
  Fly   226 --C-TLGLPAGFARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 50/217 (23%)
Tryp_SPc 108..335 CDD:214473 48/215 (22%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 50/217 (23%)
Tryp_SPc 29..244 CDD:214473 48/215 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.