DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:284 Identity:61/284 - (21%)
Similarity:98/284 - (34%) Gaps:81/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GDVLPNKQTCGQTTPVF------RDRGAENAELNEYPWMVLLLYENRL----SLIR--YVLTAAH 140
            |..:|...| .:.|||.      |......||..:.|:.|.|.:....    |:|.  :||||.|
  Fly    17 GATMPRLAT-EKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEH 80

  Fly   141 CVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQT-TVHQGFT---SSGGTYRN--- 198
            |:                 |::  |.:|         |..|.| ..:..||   .:|...::   
  Fly    81 CI-----------------GDA--DSVT---------VYFGATWRTNAQFTHWVGNGNFIKHSSA 117

  Fly   199 DIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN---LQISGWDPTKSSQTLITSTVKERNP---- 256
            ||||:|:.. |.:...:..:.|........|.|   ....||..|.....|         |    
  Fly   118 DIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL---------PDYLQ 172

  Fly   257 ---------ADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYG 312
                     ::|...|.|. ..:.:|........||.|.||.|::...|:.      |.|:.::|
  Fly   173 CVDLQIIHNSECSGYYGSV-GDNILCVRTPDGKSTCGGDSGGPLVTHDGTK------LVGVTNFG 230

  Fly   313 QQYCYSAGIPGVYTKIGHFSEWIK 336
            ......:|.|..:.::.:..:||:
  Fly   231 SVAGCQSGAPAGFQRVTYHLDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 54/258 (21%)
Tryp_SPc 108..335 CDD:214473 52/255 (20%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/258 (21%)
Tryp_SPc 40..256 CDD:238113 54/260 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.