DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG33465

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:291 Identity:74/291 - (25%)
Similarity:101/291 - (34%) Gaps:79/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNE-----YPWMVLLLYENRL----SLIR--YV 135
            |.|..|..:|..|  |..      .:.:||...|.     .|||..:...|:.    :|:.  :|
  Fly    13 VLCQGLAQLLDKK--CHD------PKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFV 69

  Fly   136 LTAAHCV---------IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTS 191
            ||||.|:         .|.|....|           .:....:|      ...|.....|..|..
  Fly    70 LTAASCISKDSQLYVLFGMYNQYRD-----------ASQFFNNE------QYGVAVALQHSNFRP 117

  Fly   192 SGGTYRNDIALLRLQFPVRYTKKIQPICLL------DAEFPLQDLNLQISGWD---PTKSSQTLI 247
            :.|.  |||.||||...|.:...|:|||::      .|.|.    ..:..||.   ...|||...
  Fly   118 NNGV--NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFE----RFEGFGWQQQGTEASSQVRQ 176

  Fly   248 TSTVKERNPADC--------LNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVF 304
            |..:.::.|.:|        :|.       .|.|| |.|....|...||||:......||.....
  Fly   177 TVYLSQKKPFECHRNGQLLPINE-------GQFCA-GNRDRSFCRSNSGSPLTADFTYGVKNITV 233

  Fly   305 LAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ..|:.|||.:.|...   .|||.:..|.:||
  Fly   234 QVGLVSYGSELCSPT---SVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/1 (100%)
Tryp_SPc 108..338 CDD:238113 68/265 (26%)
Tryp_SPc 108..335 CDD:214473 66/263 (25%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/250 (26%)
Tryp_SPc 46..261 CDD:214473 63/248 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.