DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG10469

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:105/263 - (39%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GQTTPVFRDRGAENAELNEYPWMV-LLLY-----------ENRLSLIRYVLTAAHCVIGGYLTQN 150
            ||.|...|......|:..:.|:.| ||.|           ...:...|:::|||||:..   .::
  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD---PKS 77

  Fly   151 DL--VLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTK 213
            :|  ||..|...:|..|        ..:.|....|.||:.|...  |..|||||::|...:.:.|
  Fly    78 NLWKVLIHVGKVKSFDD--------KEIVVNRSYTIVHKKFDRK--TVTNDIALIKLPKKLTFNK 132

  Fly   214 KIQPICLLDAEFPLQDLNLQISGWD------PTKSSQTLITSTVKERNPADCLNRYPSFRSASQV 272
            .|||..|..|:.........||||.      |::..|.:....:..:......|:....:|...|
  Fly   133 YIQPAKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVV 197

  Fly   273 CAG----GQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSE 333
            ..|    ..:||..|.|.||.|::...||..     |.||.|:|........:|.|.|::..:.:
  Fly   198 HNGFICIDSKKGLPCRGDSGGPMVLDDGSRT-----LVGIVSHGFDGECKLKLPDVSTRVSSYLK 257

  Fly   334 WIK 336
            |||
  Fly   258 WIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 66/253 (26%)
Tryp_SPc 108..335 CDD:214473 63/250 (25%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 64/253 (25%)
Tryp_SPc 24..260 CDD:238113 64/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.