DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:227 Identity:57/227 - (25%)
Similarity:84/227 - (37%) Gaps:66/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YVLTAAHCVIGGYLTQNDLVLKSV--------RLGESTTDCITSESRCPHLDVEVGQTTVHQGFT 190
            :|:||.||..|         ::||        ||....|..:.......|               
  Fly    75 WVMTAKHCTDG---------MESVTIYYGALWRLQAQYTHWVGRSDFIEH--------------- 115

  Fly   191 SSGGTYRNDIALLRLQFPVRYTKKIQPICLLD-AEFPLQD---LNLQ-----ISGWDPTKS---- 242
            .||     ||:|:|       |..:....|:: .|.|..|   .|.|     :|||..|..    
  Fly   116 GSG-----DISLIR-------TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGV 168

  Fly   243 SQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAG 307
            |:.|....|:....:.|.|.|.|| |...:|........||:|.||.|:  ::..|..:    .|
  Fly   169 SEYLNCVDVQIGENSVCENYYGSF-SGDLICIPTPENKGTCSGDSGGPL--VIHDGNRQ----VG 226

  Fly   308 IASYGQQY-CYSAGIPGVYTKIGHFSEWIKAN 338
            |.|:|... |.|.|..|: .::..:.:||:.|
  Fly   227 IVSFGSSAGCLSNGPKGM-VRVTSYLDWIRDN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 56/225 (25%)
Tryp_SPc 108..335 CDD:214473 54/222 (24%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 54/222 (24%)
Tryp_SPc 41..257 CDD:238113 56/225 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.