DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:245 Identity:58/245 - (23%)
Similarity:99/245 - (40%) Gaps:67/245 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PWMVLLLYENRL--------SLI--RYVLTAAHCVIG-GYLTQNDLVLKSVRLGESTTDCITSES 171
            |::|.|.::|..        |:|  .:|||||||..| .|:|        :..|.    ....:.
  Fly    49 PYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVT--------ISYGA----VWRQQP 101

  Fly   172 RCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLD-AEFPLQDLNLQ-- 233
            :..|.|.               |...|||||:|       |..:....|:: .|.|..|....  
  Fly   102 QFTHYDT---------------GNLHNDIALIR-------TPHVDFWSLVNKVELPRYDDRYNNF 144

  Fly   234 ------ISGW----DPTKSSQTLITSTVKERNPADCLNRYPS-FRSASQVC-AGGQRKGDTCAGI 286
                  :|||    |.:..:..|....::..:.:.||:.|.| :.:::.:| |..:.|| :|:|.
  Fly   145 YGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKG-SCSGD 208

  Fly   287 SGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            ||.|:  ::..|..:    .||.|:|......:..|...|::..:.:||:
  Fly   209 SGGPL--VLHDGNRQ----VGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 58/245 (24%)
Tryp_SPc 108..335 CDD:214473 56/242 (23%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 56/242 (23%)
Tryp_SPc 37..254 CDD:238113 58/245 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.