DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:118/283 - (41%) Gaps:72/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMV-LLLYENRL-------SLI--RYVLTAA 139
            |.:||:      .|:.|      |..||.:.::|:.| |.|..:.|       |||  .:|||||
  Fly    29 PVVGDI------GGRIT------GGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAA 81

  Fly   140 HCVIGGYLTQNDLVL--KSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIAL 202
            ||..|   .|:..|.  .:||.....|..::|.      |:     .:|.|:.|:  ..||||:|
  Fly    82 HCTDG---VQSVTVYLGATVRTSAEITHTVSSS------DI-----IIHSGWNSA--NLRNDISL 130

  Fly   203 LRLQFPVRYTK----KIQPICLLDAEFPLQDLNLQISGWDPTKSSQ------------TLITSTV 251
            :::......::    |:..|....:.| :.|:.: .|||..|..:.            |:||:| 
  Fly   131 IKIPATSSSSRISAVKLPSISNSYSTF-VGDVAV-ASGWGRTSDTSSGVATNLQYVDLTVITNT- 192

  Fly   252 KERNPADCLNRY-PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY 315
                  .|...| .|..:.|.:|........||.|.||.|:  ::.|..::.    |:.|:|...
  Fly   193 ------KCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPL--VLKSSSEQI----GLTSFGASA 245

  Fly   316 CYSAGIPGVYTKIGHFSEWIKAN 338
            ....|.|..:|::..:.:|||.|
  Fly   246 GCEKGYPAAFTRVTSYLDWIKTN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 67/258 (26%)
Tryp_SPc 108..335 CDD:214473 64/255 (25%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/264 (25%)
Tryp_SPc 38..268 CDD:238113 68/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.