DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG14990

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:279 Identity:78/279 - (27%)
Similarity:117/279 - (41%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PNKQTCGQTTP--------VFRDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCV 142
            || |.||.:.|        |.:|....    .::||:|.|..:.:.    |||  ..|||||..|
  Fly    44 PN-QVCGMSNPNGLVANVKVPKDYSTP----GQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIV 103

  Fly   143 IGGYLTQNDLVLKSVRLGESTT----DCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALL 203
            :|  .|..::|   ||.||..|    :.:.||.|      .|.:...|:.|:...|.  |:||||
  Fly   104 VG--KTDAEIV---VRAGEWNTGQRSEFLPSEDR------PVARVVQHREFSYLLGA--NNIALL 155

  Fly   204 RLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITSTVKE-----RNPADCLNRY 263
            .|..|......|:.|||.............::||.....:....::..|:     .|.|.|.::.
  Fly   156 FLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQL 220

  Fly   264 PSFR-------SASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGI 321
            .:.|       .||.:||||::....|.|..||.:...|.:....:. .|||.::|.. |....:
  Fly   221 RNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYE-QAGIVNWGIG-CQEENV 283

  Fly   322 PGVYTKIGHFSEWIKANLA 340
            |.|||.:..|.:||..::|
  Fly   284 PAVYTNVEMFRDWIYEHMA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/251 (27%)
Tryp_SPc 108..335 CDD:214473 67/248 (27%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/251 (27%)
Tryp_SPc 67..297 CDD:214473 67/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.