DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG13430

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:228 Identity:65/228 - (28%)
Similarity:97/228 - (42%) Gaps:62/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTY--- 196
            :|||||||: .|......|   :|.|.|.                          .:.||:|   
  Fly    67 ILTAAHCVL-EYSKPQYYV---IRAGSSD--------------------------WTKGGSYIRV 101

  Fly   197 ---------------RNDIALLRLQFPVRYTKKIQPICLLDA-EFPLQDLNLQISGWDPTKSSQ- 244
                           .||||:::||.|:.|::.|:||.|..: :..:....|.:|||..|..|| 
  Fly   102 KKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQM 166

  Fly   245 ----TLITSTVKERNPADCLNRYPSFRSASQV--CAGGQRKG-DTCAGISGSPVMGIMGSGVDEF 302
                .|..:.|..|:...|...|....:.:..  |||.|..| |:|.|.||.|::    :.:|..
  Fly   167 QPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLV----TSIDGR 227

  Fly   303 VFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            :.|.||.|:|.. |.:|..||:|||:..:.:||
  Fly   228 LKLYGIVSWGFG-CANAMFPGIYTKVSAYDDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/228 (29%)
Tryp_SPc 108..335 CDD:214473 63/226 (28%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 63/226 (28%)
Tryp_SPc 32..262 CDD:238113 65/228 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.