DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG13527

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:100/272 - (36%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TTPVFRDRGAENAELNEYPWMVLLLYENR-----------LSLIRYVLTAAHCVIGGYLTQNDLV 153
            ::|.|  .|.|..||.:|...:.....|:           |...::|:||||||:|    |:.::
  Fly    28 SSPKF--HGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMG----QSKIM 86

  Fly   154 LKSVRL--------------GESTTDCITSESRCPHLDVEVGQT-TVHQGFTSSGGTYRNDIALL 203
            .|:..|              |:|....::|        :.|.:. |:|..|         ::||:
  Fly    87 YKARWLLVVAGSPHRLRYTPGKSVCSPVSS--------LYVPKNFTMHNTF---------NMALM 134

  Fly   204 RLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITS----TVKERNPADCLNRYP 264
            :||..:...........|..|.|...:...:.||........|...    .|...:.|.|...:.
  Fly   135 KLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFR 199

  Fly   265 SFRSASQVCAGGQR---KGDTCAGISGSPVMGIMGSGVDEFVFLAGIASY--GQQYCYSAGIPGV 324
            .: ....:|||...   ..:.|:|..|||::    ||    ..:.||.:|  |   |....||.|
  Fly   200 HY-GDGMMCAGNNNWTIDAEPCSGDIGSPLL----SG----KVVVGIVAYPIG---CGCTNIPSV 252

  Fly   325 YTKIGHFSEWIK 336
            ||.:.....||:
  Fly   253 YTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/264 (23%)
Tryp_SPc 108..335 CDD:214473 58/261 (22%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 56/255 (22%)
Tryp_SPc 43..263 CDD:214473 54/252 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.