DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30283

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:281 Identity:82/281 - (29%)
Similarity:121/281 - (43%) Gaps:60/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VYVCCPELGDVLPNKQTCGQTTPV--FRDRGAENAELNEYPWMVLLLYENRL----SLI--RYVL 136
            |.|...|.|..|  :..|| |.|:  |:..|..||.:...|||.:::.|...    :||  |:||
  Fly    18 VVVLGSESGSFL--EHPCG-TVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVL 79

  Fly   137 TAAHCVIGGYLTQNDLVLKSVRLG----ESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYR 197
            |:|||:..|.|        .||||    |:.......::...|.|....|               
  Fly    80 TSAHCIANGEL--------KVRLGVLEREAEAQKFAVDAMFVHTDYYFDQ--------------- 121

  Fly   198 NDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQIS---------GWDPTK---SSQTLITST 250
            :|:|||||...|.|:..|.|||||     |..|...|.         ||..|:   ||:.|..::
  Fly   122 HDLALLRLAKRVHYSDNISPICLL-----LDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTS 181

  Fly   251 VKERNPADCLNRYPSFR-SASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQ 314
            :...:.::|..:||..: :.:.:|| .....:||.|.||.|:..|:.....:.||..|:.|:|..
  Fly   182 LFNLHRSECAKQYPHQQINRNHICA-ESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHA 245

  Fly   315 YCYSAGIPGVYTKIGHFSEWI 335
            .|..|   .|:|.:....:||
  Fly   246 DCSKA---TVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/3 (67%)
Tryp_SPc 108..338 CDD:238113 72/251 (29%)
Tryp_SPc 108..335 CDD:214473 70/249 (28%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 70/252 (28%)
Tryp_SPc 43..266 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.