DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG10764

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:280 Identity:84/280 - (30%)
Similarity:129/280 - (46%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSL------IRY 134
            ||.::.:|..|.......:..||.:|......|.:.||.|.. ||..:...:....      :|:
  Fly     9 LLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSI-WMAAIFNSSDFQCGGTIIHMRF 72

  Fly   135 VLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRND 199
            ||:||||::.||    ||.   ||||...    .:|....|..:.|   .||..|.:|  .||||
  Fly    73 VLSAAHCLVRGY----DLY---VRLGARN----INEPAAVHTVINV---FVHHDFIAS--EYRND 121

  Fly   200 IALLRLQFPVRYTKKIQPICL-LDAEF--PLQDL-NLQISGWDPTKSSQTLITSTV----KERNP 256
            |.||:|...:.||.::||||: ||...  .::.| ..:..||.......:::..|:    .:|| 
  Fly   122 IGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLKRN- 185

  Fly   257 ADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPV-MGIMGSGVDEFVFLAGIASYGQQYCYSAG 320
             :|..:.....::.|:|| |.:.||||.|.||.|: ..|:......:....||.|:|...|  .|
  Fly   186 -ECKRKLNFNLNSRQICA-GTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPEC--RG 246

  Fly   321 IPGVYTKIGHFSEWIKANLA 340
            : ||||.:..:.:||.:.:|
  Fly   247 V-GVYTDVTSYVDWISSTIA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/7 (29%)
Tryp_SPc 108..338 CDD:238113 76/244 (31%)
Tryp_SPc 108..335 CDD:214473 74/241 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 74/245 (30%)
Tryp_SPc 38..263 CDD:238113 76/247 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.