DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Prss48

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:281 Identity:73/281 - (25%)
Similarity:113/281 - (40%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDL 152
            :..||:.....|..|.::|.|..:||.|.|.::...    |||  .:|||||||:...:.:    
Mouse    28 QSVCGRPVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYS---- 88

  Fly   153 VLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTY--------------RNDIALL 203
            .|.||.||                       ::.:.::|:|..|              ..|||||
Mouse    89 FLYSVWLG-----------------------SIDREYSSTGKEYYVSRIAIPDKHRHTEADIALL 130

  Fly   204 RLQFPVRYTKKIQPICLLDAEFPLQ-DLNLQISGWDPTKSSQ----------TLITSTVKER--N 255
            :|...|.::..|.||||.:....|. ..:..::||...:...          .:|:|...|:  |
Mouse   131 KLSSRVTFSSVILPICLPNISKQLTVPASCWVTGWGQNQEGHYPSTLQELEVPVISSEACEQLYN 195

  Fly   256 PADCLNRYPSFR---SASQVCAG-GQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYC 316
            |....  .|...   .....||| .|.:.|:|.|.||.|    :...:|....|.|:.|:|.: |
Mouse   196 PIGVF--LPDLERVIKEDMFCAGERQSRKDSCKGDSGGP----LSCHIDGVWRLMGVVSWGLE-C 253

  Fly   317 YSAGIPGVYTKIGHFSEWIKA 337
             ...:|||||.:.::.:||.|
Mouse   254 -GKDLPGVYTNVTYYQKWISA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/267 (26%)
Tryp_SPc 108..335 CDD:214473 67/263 (25%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 68/266 (26%)
Tryp_SPc 40..274 CDD:238113 70/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.