DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG8299

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:105/247 - (42%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRLSL---------IRYVLTAAHCVIGGYLTQNDLVLKSVRLGEST 163
            |.:.|::.::|:.|.:..|..:.|         .|.|:|||||:.|.|.:...:|     .|:::
  Fly    30 GGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIV-----AGQNS 89

  Fly   164 TDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQ 228
            ...:..:.      |:|.:...|.|:...  ||.|||.|:..:.|:.|:..:|||.:. .|.|..
  Fly    90 IADLEEQG------VKVSKLIPHAGYNKK--TYVNDIGLIITREPLEYSALVQPIAVA-LEAPPS 145

  Fly   229 DLNLQISGWDPTKSSQTLITSTVK-------ERNPADCLNRYPSFRSASQVCAGGQRKG--DTCA 284
            .....:|||.........:.:.::       |::..........:....::...|..:|  |||.
  Fly   146 GAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCN 210

  Fly   285 GISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            |.||.|:      .||.  .|.|:.|:|.. |...|.|||||.:....:||:
  Fly   211 GDSGGPL------AVDG--VLVGVVSWGVG-CGREGFPGVYTSVNSHIDWIE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 62/247 (25%)
Tryp_SPc 108..335 CDD:214473 60/244 (25%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 60/244 (25%)
Tryp_SPc 28..255 CDD:238113 62/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.