DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG12133

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:334 Identity:127/334 - (38%)
Similarity:171/334 - (51%) Gaps:53/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPEL-GDVLPNKQTCGQTTPVFRDRGA 109
            |.||.||.||..:|..:.::.|.::|..|||:|||:.|||.: ||.||:.:.|||:.|.....|.
  Fly     1 MKILHPRNMTNDQKSQYRNKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRVCGQSPPSSYIVGG 65

  Fly   110 ENAELNEYPWMVLLLYE-------------NRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGE 161
            ..|:.|::||.|||.||             ..|...|||||||||     |..||..:..|||||
  Fly    66 MEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHC-----LNVNDFYVARVRLGE 125

  Fly   162 STTDCITSESRCP---------HLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQP 217
            ..|:.....:..|         |:|::|.....|:.:.:..|.:.||||||||:..|:||.:|:|
  Fly   126 HDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRP 190

  Fly   218 ICLLDA---------EFPLQDLNLQISGWDPT---KSSQTLITSTVKERNPADCLNRYPSF--RS 268
            ||:...         .||     .||:||..:   :.|..|...|:...:|.:||||||:.  ..
  Fly   191 ICIWPGIELSTSSFKNFP-----FQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDK 250

  Fly   269 ASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYG---QQYCYSAGIPGVYTKIGH 330
            ..|:||.|....||..|.||||:|..:|.|.|:|.:||||.|||   ..|.|.   |.||||...
  Fly   251 DIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYG---PAVYTKTSS 312

  Fly   331 FSEWIKANL 339
            :.||||..:
  Fly   313 YYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 16/37 (43%)
Tryp_SPc 108..338 CDD:238113 100/268 (37%)
Tryp_SPc 108..335 CDD:214473 97/265 (37%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 100/270 (37%)
Tryp_SPc 62..317 CDD:214473 97/267 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.