DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and PRSS41

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:305 Identity:89/305 - (29%)
Similarity:121/305 - (39%) Gaps:60/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRD------RGAENAELNEYPWMV 121
            |.|..|....||      ::|..|..:.....:.||.     |:      .|.|:|. ..:||..
Human    34 ARRPGGGGREGH------FLCPAESQEEELLSEACGH-----REIHALVAGGVESAR-GRWPWQA 86

  Fly   122 LLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT-----DCITSESRCPH 175
            .|....|.    ||:  |:||:||||....|....    .:|:|||.|:     :.....||...
Human    87 SLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSE----WTVQLGELTSRPTPWNLRAYSSRYKV 147

  Fly   176 LDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFP-LQDLNLQISGWDP 239
            .|:.|....:        |..|||||||||...|.|...|||||:..:.|. :...:..::||..
Human   148 QDIIVNPDAL--------GVLRNDIALLRLASSVTYNAYIQPICIESSTFNFVHRPDCWVTGWGL 204

  Fly   240 TKSSQTLITS---------TVKERNPADCLNRYPSFRSA---SQVCAGGQRKG-DTCAGISGSPV 291
            ...|.|.:..         |:......:.|...||.||.   |..|||.:... |||.|.||.|:
Human   205 ISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPL 269

  Fly   292 MGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            :    ...|...:..||.|:|.. |.....|||||.|..:..||:
Human   270 V----CDKDGLWYQVGIVSWGMD-CGQPNRPGVYTNISVYFHWIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 5/20 (25%)
Tryp_SPc 108..338 CDD:238113 79/254 (31%)
Tryp_SPc 108..335 CDD:214473 77/251 (31%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.