DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG8586

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:441 Identity:103/441 - (23%)
Similarity:160/441 - (36%) Gaps:132/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVLLQAIFFNQLAECVRLSSCQKDEKCTRLVSCSPLMNI----LRPRGM----TQ------AEK 59
            :.:||....|:...:.:. :.|..||:||.|..|....:.    :|||..    ||      |:.
  Fly     8 VFLLLSLCAFSMGQDTIS-AMCLSDERCTSLKRCEDSDDSGRRGIRPRSSRICGTQRVCCEKAQL 71

  Fly    60 DVF--------------------------AHRQCG---------------LDPNGHELLH----- 78
            |.:                          .:..||               ::.:|..|::     
  Fly    72 DSYDRWLVERTTTVPSTIRNKVSSVLEPPPNESCGQNMECVPRKLCRDNIINDSGISLINPRISP 136

  Fly    79 -----MVYVCC-----------PELGDVLPNK-QTCGQTTP--VFRDRG----AENAEL-NEYPW 119
                 .:|.||           |.|......| :.||.:.|  :..|..    :|:..: .|:||
  Fly   137 IQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKFPYSEDVSIFGEFPW 201

  Fly   120 MVLLLYENRLSLI--------RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHL 176
            || .::..|...:        |.|:|.:|.::..  |.:.||   .|.|:  .|..:.....||.
  Fly   202 MV-GIFTGRQEFLCGGTLIHPRLVVTTSHNLVNE--TVDTLV---ARAGD--WDLNSLNEPYPHQ 258

  Fly   177 DVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFP-----LQDLNLQISG 236
            ...:.:..:|..|..:  :..||||||.|..|:|....|||:||...|.|     |..:....:|
  Fly   259 GSRIKEIIMHSEFDPN--SLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATG 321

  Fly   237 WDPTKSSQTLITSTVKERN-----PADCLNRY------------PSFRSASQVCAGGQRKGDTCA 284
            |...::....:...:|..|     ..:|..:.            |||     :||||....|||.
  Fly   322 WGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSF-----ICAGGDPGKDTCK 381

  Fly   285 GISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            |..|||:...|...:|.:. |.||.|:|.: |....||.||..:.|...||
  Fly   382 GDGGSPLFCQMPGEMDRYQ-LVGIVSWGVE-CAVEDIPAVYVNVPHLRGWI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 16/113 (14%)
Tryp_SPc 108..338 CDD:238113 72/263 (27%)
Tryp_SPc 108..335 CDD:214473 70/261 (27%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 71/251 (28%)
Tryp_SPc 197..430 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.