DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon44E

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:299 Identity:65/299 - (21%)
Similarity:109/299 - (36%) Gaps:81/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VYVCCPELGD--VLPNKQTCGQTTPVF---RDRGAENAELNEYPWMVLLLYENRLSLI------- 132
            |::.|..:..  |:|::.  .:..||.   |....|....|.||     .||.::..|       
  Fly     5 VFLACLAVASAGVVPSES--ARAVPVKDMPRAGKIEGRITNGYP-----AYEGKIPYIVGLSFND 62

  Fly   133 ------------RYVLTAAHCVIGGYLTQNDLVL---KSVRLGESTTDCITSESRCPHLDVEVGQ 182
                        .:|||||||.    .:.|.:::   .|.|.....|..::......|.|     
  Fly    63 GGYWCGGSIIDHTWVLTAAHCT----NSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPD----- 118

  Fly   183 TTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFP-LQDLNLQISGWDPTKSSQTL 246
               ...|.:      |||||:|:.. |.:...:..:     |.| ..|.....|||....|...|
  Fly   119 ---WNDFLN------NDIALIRIPH-VDFWSLVNKV-----ELPSYNDRYNSYSGWWAVASGWGL 168

  Fly   247 -------------ITSTVKERNPADCLNRYPS-FRSASQVCAGGQRKGDTCAGISGSPVMGIMGS 297
                         :...:.:.|  ||.|.|.| :.:.:.:|........:|:|.||.|::     
  Fly   169 TDNNSGMSNYLNCVDVQIIDNN--DCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLV----- 226

  Fly   298 GVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
             :.:...:.||.|:|.....:||.|..:|::..:.:||:
  Fly   227 -LHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/3 (33%)
Tryp_SPc 108..338 CDD:238113 58/266 (22%)
Tryp_SPc 108..335 CDD:214473 56/263 (21%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 55/259 (21%)
Tryp_SPc 41..266 CDD:238113 57/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.