DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and scaf

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:348 Identity:79/348 - (22%)
Similarity:131/348 - (37%) Gaps:74/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AECVRLSSCQKDEKCTRL-------VSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHE--LL 77
            |:|.....|..:..|..:       |..||:....|.......:.:..:..:|..|||..:  .:
  Fly   342 AKCASALVCTSENFCNAIGVLSETPVELSPMEAAFRVPLTDCLQTENGSPGKCCRDPNYVDPWPV 406

  Fly    78 HMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELN--EYPWMVLLLYENRLSLI-------- 132
            ::..||...      ||:|        :..|.::.:.|  |.||..::|.|:..:||        
  Fly   407 NLAGVCATR------NKRT--------KPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGD 457

  Fly   133 RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYR 197
            ::||::|.||       |.|.:..:|:.....:..::....|.....|....||..:..|  |..
  Fly   458 QFVLSSASCV-------NGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPS--TNS 513

  Fly   198 NDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTL----------ITSTVK 252
            :|:|::||:..:.:...|||||:.| |.|........|||    ..|.|          :|.|:.
  Fly   514 HDLAIIRLERRLEFASHIQPICISD-EDPKDSEQCFTSGW----GKQALSIHEEGALMHVTDTLP 573

  Fly   253 ERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCY 317
            :.. ::|      ...:|.||:.  .|.|:|....||.:....||.|......||..|.|:....
  Fly   574 QAR-SEC------SADSSSVCSA--TKFDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTV 629

  Fly   318 SAGIPGVYTKIGHFSEWIKANLA 340
            ....|.:        :||....|
  Fly   630 RFAKPDI--------KWINTAFA 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 10/57 (18%)
Tryp_SPc 108..338 CDD:238113 61/249 (24%)
Tryp_SPc 108..335 CDD:214473 59/246 (24%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 53/210 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.