DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Prss21

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:285 Identity:88/285 - (30%)
Similarity:127/285 - (44%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWM-VLLLYENRL---SLI--RYVLTAAHCVI 143
            |||.:.......||..|...|..|.|.|||..:||. .|.::.|.|   :|:  |:|||||||  
  Rat    37 PELQEANLLSGPCGHRTIPSRIVGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHC-- 99

  Fly   144 GGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGT--YRNDIALLRLQ 206
              :...||....:|:.||     :||.....:|.....:..:...|.|...|  :.:|||||:|.
  Rat   100 --FQKDNDPFDWTVQFGE-----LTSRPSLWNLQAYSNRYQIEDIFLSPKYTEQFPHDIALLKLS 157

  Fly   207 FPVRYTKKIQPICLLDAEFPLQD-LNLQISGWDPTKSSQTL-ITSTVKE-----RNPADC--LNR 262
            .||.|:..|||||||::.:...: .:..::||......::| :.:.::|     .|...|  |.:
  Rat   158 SPVTYSNFIQPICLLNSTYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFK 222

  Fly   263 YPSFRS---ASQVCAGGQRKG-DTC---------AGISGSPVMGIMGSGVDEFVFLAGIASYGQQ 314
            .|.||.   ...||||....| |.|         .|.||.|::    ...|...:..|:.|:|..
  Rat   223 KPDFRINIWGDMVCAGSPEGGKDACFAKLTYAAPQGDSGGPLV----CNQDTVWYQVGVVSWGIG 283

  Fly   315 YCYSAGIPGVYTKIGHFSEWIKANL 339
             |.....|||||.|.|...||:..:
  Rat   284 -CGRPNRPGVYTNISHHYNWIRLTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 81/259 (31%)
Tryp_SPc 108..335 CDD:214473 79/256 (31%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 80/259 (31%)
Tryp_SPc 58..304 CDD:238113 80/259 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.