DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and SPH93

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:303 Identity:84/303 - (27%)
Similarity:126/303 - (41%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGL-DPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL- 129
            ||: :.||.:::..:               |..|..|.            :|||.|.:.:..:. 
  Fly   233 CGMSNANGLQMVEGI---------------TIDQARPA------------QYPWAVAIFHNGQYL 270

  Fly   130 ---SLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGE----STTDCITSESRCPHLDVEVGQTTV 185
               |||:  .|||.||.||   ..:.:||   ||.|:    |..:...||.|      ||.:..:
  Fly   271 AGGSLIQPNVVLTVAHRVI---TIETELV---VRAGDWDLKSDREIFLSEQR------EVERAVI 323

  Fly   186 HQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITST 250
            |:||....|.  |::|||.|..|.:....|:.|||.............::||...:......::.
  Fly   324 HEGFDFKSGA--NNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTV 386

  Fly   251 VKE-------RNPADCLNRYPSFRSASQ-------VCAGGQRKGDTCAGISGSPVMGIMG---SG 298
            :|:       ||..:...|  |.|..::       :||||:...|||.|..||.:...:|   ||
  Fly   387 LKKVQLLVVNRNVCEKFLR--STRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSG 449

  Fly   299 VDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLAP 341
            |.|   .|||.::|.. |...|||.:||::..|:.||...|.|
  Fly   450 VYE---QAGIVNWGVG-CGQEGIPAIYTEVSKFTNWITEKLLP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 4/17 (24%)
Tryp_SPc 108..338 CDD:238113 75/256 (29%)
Tryp_SPc 108..335 CDD:214473 73/253 (29%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 77/266 (29%)
Tryp_SPc 252..482 CDD:214473 74/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.