DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG9377

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:328 Identity:85/328 - (25%)
Similarity:127/328 - (38%) Gaps:58/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EKDVFAHRQC--GLDPNG-----------HELLHMVYVCCPELGDVLPNKQ--------TCGQTT 101
            ||....:.||  ||..:|           .|..|.:..|| .:.|.||..:        .||...
  Fly    28 EKHCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHYMEKCC-NIPDKLPTPKIPEEMMSCPCGGRH 91

  Fly   102 PVF---RDRG--AENAELNEYPWMVLL------LYENRLSLIRYVLTAAHCVIGGYLTQNDLVLK 155
            .::   |..|  .:.|:..|:||:|.:      |....|.....|:|.||||      ||. .::
  Fly    92 DLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCV------QNS-EME 149

  Fly   156 SVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL 220
            .|||.....|........||....|.:|.||..:|.....:...|.|:..:.|.:....:|||||
  Fly   150 KVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL 214

  Fly   221 LDAEFPLQDLNLQISGWDPTKSSQTLITS---TVKERNPADC--------LNRYPSFRSASQVCA 274
            .............:|||..:...:..|..   |:....|..|        |.|..: .:.|.:||
  Fly   215 PPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHA-HNDSLLCA 278

  Fly   275 GGQRKGDTCAG---ISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            ||. |||...|   ::..|:|..: ||.|:...|||:.:...: |....:.|:||.:..:.:||.
  Fly   279 GGD-KGDFVCGDVDMTAVPLMCPL-SGHDDRFHLAGLLTRTAR-CDGPQLLGIYTNVKLYRQWID 340

  Fly   337 ANL 339
            ..|
  Fly   341 LKL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/38 (24%)
Tryp_SPc 108..338 CDD:238113 67/251 (27%)
Tryp_SPc 108..335 CDD:214473 65/248 (26%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 65/245 (27%)
Tryp_SPc 105..339 CDD:214473 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.