DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:278 Identity:82/278 - (29%)
Similarity:123/278 - (44%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDR----GAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQND 151
            ||...||..|:    |..||..:|:||:.:|....:.    |||  .::|||||||  ..:|..|
  Fly   387 CGNKNPVTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCV--ARMTSWD 449

  Fly   152 LVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQ 216
            :...:..||:..   |.::....|:...:.:...|:||..|  |..||:|:|.|..||.:|::||
  Fly   450 VAALTAHLGDYN---IGTDFEVQHVSRRIKRLVRHKGFEFS--TLHNDVAILTLSEPVPFTREIQ 509

  Fly   217 PICLLDAEFPLQDLN------LQISGWDPTKSSQTLITSTVKERNP---------------ADCL 260
            ||||..:  |.|...      ..::||           .:::|..|               |:|.
  Fly   510 PICLPTS--PSQQSRSYSGQVATVAGW-----------GSLRENGPQPSILQKVDIPIWTNAECA 561

  Fly   261 NRY----PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGI 321
            .:|    |.....|.:|| ||...|:|:|.||.|::...|....:    .||.|:|.. |.....
  Fly   562 RKYGRAAPGGIIESMICA-GQAAKDSCSGDSGGPMVINDGGRYTQ----VGIVSWGIG-CGKGQY 620

  Fly   322 PGVYTKIGHFSEWIKANL 339
            |||||::.....||..|:
  Fly   621 PGVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 76/260 (29%)
Tryp_SPc 108..335 CDD:214473 74/257 (29%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 74/260 (28%)
Tryp_SPc 400..637 CDD:238113 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.