DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and PRSS48

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:276 Identity:76/276 - (27%)
Similarity:118/276 - (42%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDR--GAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLV 153
            |||  ||:..|  |.::|....:||.|.|.:::..    ||:  |.:||||||:...:.|.:..|
Human    42 CGQ--PVYSSRVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSYTV 104

  Fly   154 -LKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQP 217
             |.|:.:|:|.          ..:...|.:..:|..:..:..    |:|||:|...|.:|..|.|
Human   105 WLGSITVGDSR----------KRVKYYVSKIVIHPKYQDTTA----DVALLKLSSQVTFTSAILP 155

  Fly   218 ICLLDAEFPLQDLNLQI------SGWDPTKSS------QTLITSTVKERNPADCLNRY------- 263
            |||     |.....|.|      :||...|.|      ..|..:.|...:...|...|       
Human   156 ICL-----PSVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFL 215

  Fly   264 PSFR---SASQVCAGG-QRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGV 324
            |:..   ...::|||. |...|:|.|.||.|    :...:|......|:.|:|.: | ...:|||
Human   216 PALEPVIKEDKICAGDTQNMKDSCKGDSGGP----LSCHIDGVWIQTGVVSWGLE-C-GKSLPGV 274

  Fly   325 YTKIGHFSEWIKANLA 340
            ||.:.::.:||.|.::
Human   275 YTNVIYYQKWINATIS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/259 (27%)
Tryp_SPc 108..335 CDD:214473 67/256 (26%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 68/259 (26%)
Tryp_SPc 51..288 CDD:238113 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.