DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and OVCH2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:308 Identity:79/308 - (25%)
Similarity:117/308 - (37%) Gaps:95/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LPNKQTCGQTT---------PVF-RDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAA 139
            ||...:|||:.         .:| |..|....|...|||.|.|....:.    |::  ::|:|||
Human    31 LPKAPSCGQSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLKQRQKHICGGSIVSPQWVITAA 95

  Fly   140 HCVIGGYLTQNDLVLKSVRLGE---STTD----CITSESRCPHLDVEVGQTTVHQGF-TSSGGTY 196
            ||:    ..:|.:...:|..||   |.||    .:|.|:           ..:|..| |.....|
Human    96 HCI----ANRNIVSTLNVTAGEYDLSQTDPGEQTLTIET-----------VIIHPHFSTKKPMDY 145

  Fly   197 RNDIALLRLQFPVRYTKKIQPICL------LDAEF------------------PLQDLNLQISGW 237
              |||||::....::...:.||||      .:|.|                  .||::||.|..|
Human   146 --DIALLKMAGAFQFGHFVGPICLPELREQFEAGFICTTAGWGRLTEGGVLSQVLQEVNLPILTW 208

  Fly   238 DPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDE 301
            :...::  |:|           |.|..|.::.  :|.|....| |.|.|.||..:|.....|.  
Human   209 EECVAA--LLT-----------LKRPISGKTF--LCTGFPDGGRDACQGDSGGSLMCRNKKGA-- 256

  Fly   302 FVFLAGIASYGQQYC----------YSAGIPGVYTKIGHFSEWIKANL 339
             ..|||:.|:|.. |          ...|.||::|.|.....||..::
Human   257 -WTLAGVTSWGLG-CGRGWRNNVRKSDQGSPGIFTDISKVLPWIHEHI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 72/278 (26%)
Tryp_SPc 108..335 CDD:214473 70/275 (25%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 71/278 (26%)
Tryp_SPc 56..301 CDD:238113 72/280 (26%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.