DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:238 Identity:49/238 - (20%)
Similarity:84/238 - (35%) Gaps:83/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQG--------FT 190
            :|||||||..|                                   ..|.|::.|        ||
  Fly    73 WVLTAAHCTNG-----------------------------------ASQVTIYYGATWRTNAQFT 102

  Fly   191 SSGGT------------YRNDIALLRLQFPVRYTKKIQPICL--LDAEFPLQDLNLQIS-GWD-P 239
            .:.|:            ..|||||:|... |.:...:..:.|  .:..:.:.|....:: ||. .
  Fly   103 HTVGSGDFIQNHNWPNQNGNDIALIRTPH-VDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLT 166

  Fly   240 TKSSQ---------TLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIM 295
            |..||         .:|::       ::|...|.: :....:|........||:|.||.|::...
  Fly   167 TAGSQPDWMECVDLQIISN-------SECSRTYGT-QPDGILCVSTSGGKSTCSGDSGGPLVLHD 223

  Fly   296 GSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKAN 338
            |..      |.|:.|:......:||:|..:|::.:..:||:.|
  Fly   224 GGR------LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 48/236 (20%)
Tryp_SPc 108..335 CDD:214473 46/233 (20%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 46/233 (20%)
Tryp_SPc 37..260 CDD:238113 48/236 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.