DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:244 Identity:50/244 - (20%)
Similarity:76/244 - (31%) Gaps:104/244 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YVLTAAHCV---------IGGYLTQNDLVLKSVRLG----ESTTDCITSESRCPHLDV-----EV 180
            :||||.||:         .|.....|.....:|..|    .|..|  .:..|.||:|.     :|
  Fly    71 WVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNAD--IALIRIPHVDFWHMVNKV 133

  Fly   181 GQTTVHQGFTSS----------GGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQD----LN 231
            ...:.:..:.:.          ||||...                          ||.|    ::
  Fly   134 ELPSYNDRYNNYNEWWAVACGWGGTYDGS--------------------------PLPDWLQCVD 172

  Fly   232 LQI-----SGWD-PTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSP 290
            |||     .||. .:.....:.|.||..::                          .|.|.||.|
  Fly   173 LQIVHNEECGWTYGSVGDNVICTRTVDGKS--------------------------ICGGDSGGP 211

  Fly   291 VMGIMGS---GVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            ::...||   ||..||     :|.|.|    :|.|..:.::.:..:||:
  Fly   212 LVTHDGSKLVGVSNFV-----SSNGCQ----SGAPAGFQRVTYHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 50/244 (20%)
Tryp_SPc 108..335 CDD:214473 48/241 (20%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 48/241 (20%)
Tryp_SPc 37..253 CDD:238113 50/244 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.