DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG40160

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:310 Identity:86/310 - (27%)
Similarity:113/310 - (36%) Gaps:80/310 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VYVCC-----------PELGDVLPNK-QTCGQTTPVFRDRGA----------ENAELNEYPWMVL 122
            |.|||           |...|..||: :.||     .|:.|.          ..|...|:||.|.
  Fly   122 VDVCCDANRTLNKTLNPTPLDQRPNQPRGCG-----VRNTGGLDFTLSGVSQNEAGFGEFPWTVA 181

  Fly   123 LLYENRLSLI--------RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT-----DCITSESRCP 174
            ||:...||..        :.||||||||            :|:|.|..|.     |..|.:.|.|
  Fly   182 LLHSGNLSYFCAGSLIHKQVVLTAAHCV------------ESLRTGSFTVRAGEWDTQTMKERLP 234

  Fly   175 HLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ------ 233
            :.:..|....:|..:......|  |.||:.|..||.....|..|||     |.||...|      
  Fly   235 YQERSVQTVILHPDYNRRSIAY--DFALVILSQPVTLDDHINVICL-----PQQDDIPQPGNTCF 292

  Fly   234 ISGWDPTKSSQTLITSTVKERNPA------DCLNRY------PSFR-SASQVCAGGQRKGDTCAG 285
            .:||...........|::.:|.|.      .|..|.      |.|. ..|.:||||||..|||.|
  Fly   293 STGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQG 357

  Fly   286 ISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ..|:|:....||..:......||.::|.. | :..:|..|..:.....||
  Fly   358 DGGAPLACPRGSTRESRYQQTGIVAWGIG-C-NDEVPAAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/3 (67%)
Tryp_SPc 108..338 CDD:238113 75/270 (28%)
Tryp_SPc 108..335 CDD:214473 73/268 (27%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 74/261 (28%)
Tryp_SPc 169..405 CDD:214473 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.