DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and ela2l

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:266 Identity:78/266 - (29%)
Similarity:118/266 - (44%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TCGQTT--P-VFRDRGAENAELNEYPWMVLLLYENRL--------SLI--RYVLTAAHCVIGGYL 147
            :||..|  | |.|..|..:...|.:||.:.|.|::..        |||  ::|||||||:.....
Zfish    16 SCGLPTFPPIVTRVVGGVDVRPNSWPWQISLQYKSGSNWYHTCGGSLIDKQWVLTAAHCISSSRT 80

  Fly   148 TQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYT 212
            .:       |.||:.:    .|:.....:.:..|:..||:.:.|.  |.||||||::|:..|...
Zfish    81 YR-------VFLGKHS----LSQEENGSVAIGAGKIIVHEAWNSF--TIRNDIALIKLETAVTIG 132

  Fly   213 KKIQPICLLDAEFPL-QDLNLQISGWDPTKSSQTLITSTVKERNP----ADCLNR--YPSFRSAS 270
            ..|.|.||.:|.:.| .:....::||....::..|.....:...|    |.|...  :.|..:.|
Zfish   133 DTITPACLPEAGYVLPHNAPCYVTGWGRLYTNGPLADILQQALLPVVDHATCSKSDWWGSQVTTS 197

  Fly   271 QVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY-CYSAGIPGVYTKIGHFSEW 334
            .|||||......|.|.||.|:......|..|   :.||.|:|... |.....|.|:|::..:|:|
Zfish   198 MVCAGGDGVVAGCDGDSGGPLNCAGSDGAWE---VHGIVSFGSGLSCNYNKKPTVFTRVSAYSDW 259

  Fly   335 IKANLA 340
            |..|:|
Zfish   260 ISKNMA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/247 (28%)
Tryp_SPc 108..335 CDD:214473 68/244 (28%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 69/247 (28%)
Tryp_SPc 29..263 CDD:238113 70/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.