DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11911

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:114/248 - (45%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLL----LYENRL---SLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGEST 163
            |.| ||.:..|::|.|    |..:.:   :||.  :::|||||:       ::.|..|:..|..|
  Fly    40 GTE-AEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-------SEPVGMSIIAGLHT 96

  Fly   164 ---TDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEF 225
               .|.:|.:.:     |:.|:  ||:.:|...|.|  |||||.:.....:.:.:||..|...| 
  Fly    97 RAEVDELTQQRQ-----VDFGR--VHEKYTGGVGPY--DIALLHVNESFIFNEWVQPATLPSRE- 151

  Fly   226 PLQDLNLQISGWDPTKS-----SQTLITSTVKERNPADCLNRYPSFR--SASQVCAGG-QRKGDT 282
            .:.:....:.||...||     ::||.|.|.:..|..:|....|...  :.|.:|:.. |:....
  Fly   152 QVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSA 216

  Fly   283 CAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            |.|.||.|::....:...|   |.||.|:|...|..|.:|.:|||:..:.:||
  Fly   217 CNGDSGGPLVVEFTNAPSE---LIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/248 (28%)
Tryp_SPc 108..335 CDD:214473 68/246 (28%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 70/248 (28%)
Tryp_SPc 37..266 CDD:214473 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.