DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:287 Identity:75/287 - (26%)
Similarity:117/287 - (40%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PNKQTCGQTTPVFRDRGAENAELNEYPWMVLLL--YENRLSLI-------RYVLTAAHCVIGGYL 147
            |..|.....|...|....:.|...::|:.|.||  :.:..:|.       .::|||||||..   
Mosquito    43 PELQVYRNDTSTDRVVNGQEALPGQFPYQVALLLNFPDGTALCGGSVLTRNFILTAAHCVSA--- 104

  Fly   148 TQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSG---------GTYRNDIALL 203
            |...||...:.:       :.:.:|..   :|:.|..:.  |||:|         .:.|||:||:
Mosquito   105 TSTTLVSGGIAI-------MGAHNRTA---MELSQQRIR--FTSTGIRRHPEYDDTSLRNDVALI 157

  Fly   204 RLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGW-------------DPTKSSQTLITSTVKERN 255
            .|..|:.:|.:::||.|     |.:....|..|:             .|..||....||     |
Mosquito   158 LLNSPMTFTSRVKPISL-----PARTDTRQFEGFTGTVSGFGRSSDASPYPSSILRFTS-----N 212

  Fly   256 P----ADCLNRYPSFRSASQ-VC---AGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYG 312
            |    |:|:..:....:.|| ||   .||:   .:|.|.||.|:....|.     |...|..|:|
Mosquito   213 PIMSKAECIVSWGFALAQSQNVCLKPTGGR---SSCNGDSGGPLTVNSGG-----VLQIGTVSFG 269

  Fly   313 QQYCYSAGIPGVYTKIGHFSEWIKANL 339
            ..|..::|.|.||.::.:|..||..|:
Mosquito   270 SSYGCASGWPSVYARVSYFLSWINENI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/268 (26%)
Tryp_SPc 108..335 CDD:214473 68/265 (26%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 69/268 (26%)
Tryp_SPc 57..295 CDD:238113 70/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.