DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG15046

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_573298.1 Gene:CG15046 / 32833 FlyBaseID:FBgn0030927 Length:494 Species:Drosophila melanogaster


Alignment Length:316 Identity:62/316 - (19%)
Similarity:108/316 - (34%) Gaps:67/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QAIFFNQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLH 78
            ::|.|...::....::...:.:| |.||..|.:..|..:|..:.|.    ...|      .|..|
  Fly   155 ESITFRDTSDGADCTAPLYEGQC-RAVSACPSVEPLLSQGRLRDED----FTTC------REGTH 208

  Fly    79 MVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSLIRYVLTAAH--C 141
            ...:|||....:.|...| |....|..|.....|..:......:...:..|...|::.:.||  .
  Fly   209 EEIICCPLNLPLQPRVHT-GLRLGVQGDSSEGKAAEDPLELAAIARADRLLPHYRHLASLAHPNA 272

  Fly   142 VIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHL--------DVEVGQ------TTVHQGFTSS 192
            ...|:|.....::.:.:|..|...|    .|..|.        ||:..:      ..:.|     
  Fly   273 AFDGHLHHCAALVLTPQLLVSAAGC----ERPSHAVFGVADLRDVDADEDYLADIVRLVQ----- 328

  Fly   193 GGTYRNDIALLRLQFPVRYTKK------IQPICLLDAEFPLQDL----NLQISGWDPTKSSQTLI 247
               ::.|::|:|||.|:|...:      :.|||   .:|.|..|    :|...||...:.:...:
  Fly   329 ---FQKDLSLIRLQDPLRLGSQTSANVSVAPIC---TQFELTRLQRSGSLVAVGWGKGEDTDCPL 387

  Fly   248 TSTVKERNPADCLNRYPSF-----RSASQVCA---GGQRK------GDTCAGISGS 289
            ........|.......|::     ..:|.:|.   .|:|:      ..|||....|
  Fly   388 FEMPMRLRPTWACGDLPNYGGVQDLGSSHLCVEPMDGERELQRFSNSSTCAACPAS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/48 (23%)
Tryp_SPc 108..338 CDD:238113 41/222 (18%)
Tryp_SPc 108..335 CDD:214473 41/222 (18%)
CG15046NP_573298.1 CLIP 35..82 CDD:197829
CLIP 168..215 CDD:197829 12/57 (21%)
Tryp_SPc 274..>379 CDD:304450 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.