DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and psh

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:413 Identity:92/413 - (22%)
Similarity:132/413 - (31%) Gaps:169/413 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQT 100
            |.....|.||::.....|:... .||   ..|||...|.      ..||       |.|..|..:
  Fly    40 CRTSSDCEPLIDGYIKSGVLTL-NDV---PSCGLGAWGE------IFCC-------PTKPCCDNS 87

  Fly   101 T-----------------------PVF--------------RDR--------------GAENAEL 114
            |                       |.|              |:|              |....:.
  Fly    88 TITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDP 152

  Fly   115 NEYPWMVLLLY---------ENRLSLIRYVLTAAHCV-----------IGGYLTQN------DLV 153
            ..||.|..:.|         ...|...|:||||||||           :|....:|      |:|
  Fly   153 GVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIV 217

  Fly   154 LKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPI 218
            ::||:                          :|..:.  |..| ||||:|.|:..|..|..|:|.
  Fly   218 IRSVK--------------------------IHPQYV--GNKY-NDIAILELERDVVETDNIRPA 253

  Fly   219 CL-LDAEFPLQDLNLQISGWD----PTKSSQTLITSTVKERNPADCLN----RYP-SFRSASQ-- 271
            || .||..|..:....::||.    .|::...::.....|..|.|..|    ..| |.|...|  
  Fly   254 CLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGV 318

  Fly   272 ----VCAGGQRK-GDTCAGISGSP-------------VMGIMGSGVDEFVFLAGIASYGQQYCYS 318
                :||..|:. .|.|.|.||.|             :||::.||.       |.|:.       
  Fly   319 IDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGF-------GCATV------- 369

  Fly   319 AGIPGVYTKIGHFSEWIKANLAP 341
              .||:||::..:.::|:..:.|
  Fly   370 --TPGLYTRVSSYLDFIEGIVWP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/47 (23%)
Tryp_SPc 108..338 CDD:238113 70/285 (25%)
Tryp_SPc 108..335 CDD:214473 69/282 (24%)
pshNP_573297.1 CLIP 30..79 CDD:197829 13/55 (24%)
Tryp_SPc 143..384 CDD:214473 69/285 (24%)
Tryp_SPc 144..387 CDD:238113 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.