DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG31220

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:347 Identity:136/347 - (39%)
Similarity:181/347 - (52%) Gaps:45/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CQKDEKCTRLVSCSPL-MNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPN 93
            |:.||:|.||..|.|: .|:.|.|....|:.::...|.||:.....:....:|:|||:..:.||:
  Fly    27 CEPDEECIRLKDCRPIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIYICCPKPANTLPS 91

  Fly    94 KQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL--------------SLI--RYVLTAAHCV 142
            ...||:.....|..|.....||||||:.:|||.||.              |||  ||||||||||
  Fly    92 YPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCV 156

  Fly   143 IGGYLTQNDLVLKSVRLGESTT----DCITSESR--C--PHLDVEVGQTTVHQGFTSSGGTYRND 199
                 |...|.::.|||||.||    |||:..:|  |  .|||::|...|.|..:..:..|:|||
  Fly   157 -----TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRND 216

  Fly   200 IALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPT----KSSQTLITSTVKERNPADCL 260
            |||:||:.|||||....|||:||....|....:.::||..|    ..|:.|..:.||.|.|.:|.
  Fly   217 IALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECS 281

  Fly   261 NRY------PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSA 319
            .:|      |.|    |:||||.....||.|.||||:||..|...:...|||||.|||.. |.:.
  Fly   282 EKYAHRHFGPRF----QICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGP-CGTI 341

  Fly   320 GIPGVYTKIGHFSEWIKANLAP 341
            |.|.|:|:...|.:||:|:|.|
  Fly   342 GWPSVFTRTAKFYKWIRAHLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/49 (27%)
Tryp_SPc 108..338 CDD:238113 109/263 (41%)
Tryp_SPc 108..335 CDD:214473 107/260 (41%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 108/263 (41%)
Tryp_SPc 104..360 CDD:238113 109/265 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.