DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG31681

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:261 Identity:75/261 - (28%)
Similarity:109/261 - (41%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDR--GAENAELNEYPWMVL-----------LLYENRLSLIRYVLTAAHCVIGGYLT 148
            |....|...:|  |.....:...||.|.           ::|.:|.     :||||||:  ..:|
  Fly    18 CAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA-----ILTAAHCL--SNVT 75

  Fly   149 QNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYR-NDIALLRLQFPVRYT 212
            ..||   |||.|.|..      |:...: ::|.:|..|..:...  .|. .|||:|.|:.|:|..
  Fly    76 VTDL---SVRAGSSYW------SKGGQV-LKVLKTIAHPKYVPK--LYNPYDIAVLILEAPLRLG 128

  Fly   213 KKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITST-----VKERNPADCLNRYPSFR-SASQ 271
            ..::.|.|.: :.|:....:..|||..|:.:.:.:...     |...|..|||..|.... :...
  Fly   129 GTVKKIPLAE-QTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDM 192

  Fly   272 VCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGI-PGVYTKIGHFSEWI 335
            :||.||| .|||.|.||.|::.....|..:   |.|:.|:|.    ..|. ||||..|..|..||
  Fly   193 ICADGQR-WDTCQGDSGGPLIETTKGGHRQ---LIGMVSWGD----GCGTNPGVYEDIAFFHNWI 249

  Fly   336 K 336
            |
  Fly   250 K 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 72/248 (29%)
Tryp_SPc 108..335 CDD:214473 69/245 (28%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 70/248 (28%)
Tryp_SPc 29..250 CDD:238113 70/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.