DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG32808

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:251 Identity:68/251 - (27%)
Similarity:105/251 - (41%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVR 158
            :.:||.|.            ||.|                :||||||||.|....|.||...|..
  Fly    54 RHSCGATL------------LNPY----------------WVLTAAHCVRGSSPEQLDLQYGSQM 90

  Fly   159 LGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDA 223
            |..:::..           ..|....||.|:... ..|.||||||:|...|..:|.:||:.|.: 
  Fly    91 LARNSSQV-----------ARVAAIFVHPGYEPE-DKYVNDIALLQLAQSVALSKFVQPVRLPE- 142

  Fly   224 EFPLQ----DLNLQISGWDPTKS----SQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKG 280
              |.|    :.:..::||....:    .|.|....::..:..:|..|:.::...||:|||....|
  Fly   143 --PRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGG 205

  Fly   281 -DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
             ..|:|.||.|:: ::||...     .||.|:..:.|.....|||:|::..:.:||
  Fly   206 KGQCSGDSGGPLL-LIGSDTQ-----VGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/237 (27%)
Tryp_SPc 108..335 CDD:214473 63/235 (27%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 66/249 (27%)
Tryp_SPc 30..258 CDD:238113 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.