DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and sphinx1

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:243 Identity:46/243 - (18%)
Similarity:83/243 - (34%) Gaps:70/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VIGGYLTQNDLVL------------KSVRLGESTTDCITSES---------RCPHLDVEVGQTTV 185
            :.|||..:...::            .|:..|..|   |.|..         :..:::|.:.....
  Fly    26 IAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGT---IISNQWILTVKTVLKYSYIEVHLASRRS 87

  Fly   186 HQGF-------TSSGGTYRND--IALL------------RLQFPV------RYTKKIQPICLLDA 223
            ::||       .:....|.||  |||:            |::.|.      ||...:..:|    
  Fly    88 YRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVC---- 148

  Fly   224 EFPLQDLNLQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISG 288
            .:..:..:.::..|        :....|:..|..:|...|...: ..::|..|:.....|.|..|
  Fly   149 GYGTEKRHAKLPEW--------MRCIEVEVMNNTECAKYYTPLK-WYEMCTSGEGFKGVCEGDIG 204

  Fly   289 SPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            ..|: .||.. ..|:   ||.....:.| |.|.|.|:.::....:|||
  Fly   205 GAVV-TMGPN-PTFI---GIIWLMPENC-SIGYPSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 46/243 (19%)
Tryp_SPc 108..335 CDD:214473 43/240 (18%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 43/240 (18%)
Tryp_SPc 26..248 CDD:304450 46/243 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.