DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11664

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:208 Identity:57/208 - (27%)
Similarity:88/208 - (42%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYR 197
            |||||.|||    :.........|||.|..   .|..|.|    ..:|.....|..|  |..|.|
  Fly    55 RYVLTVAHC----FKKNTKPEELSVRAGYR---WIAWEFR----GKQVAGLLRHPKF--SPLTLR 106

  Fly   198 NDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNL-----QISGWDPTKSSQTLITSTVKERNPA 257
            ||||:||::..:.::..|..|.|...  ||..||:     :::||:....:|.|.:.:|:.....
  Fly   107 NDIAVLRVKAAISHSHMINYIGLCSR--PLTPLNMFAPPQELAGWNLMHIAQPLKSMSVQVEPEK 169

  Fly   258 DCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIP 322
            :|...:|.. |...:||........|.|.||.|::    ||.:    :.|:| ...:.|.....|
  Fly   170 NCRQWFPQI-SGGVICASATMGEGLCYGDSGDPLI----SGGE----VCGLA-IAFRKCGDKRYP 224

  Fly   323 GVYTKIGHFSEWI 335
            .::|.:.:...:|
  Fly   225 ALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 57/208 (27%)
Tryp_SPc 108..335 CDD:214473 56/206 (27%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 57/208 (27%)
Tryp_SPc 38..237 CDD:214473 56/206 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.