DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Klk8

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:252 Identity:83/252 - (32%)
Similarity:112/252 - (44%) Gaps:39/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RDRGAENAELNE-----YPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVR 158
            |.:|::..|..|     .||...|....||    .|:  |:|||||||....|         |||
  Rat    27 RAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHCKKDKY---------SVR 82

  Fly   159 LGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSG-GTYRNDIALLRLQFPVRYTKKIQPICLLD 222
            ||:.:    ..:...|..:::|.::..|..|.||. ..:.:||.|:|||.......|::||.|.:
  Rat    83 LGDHS----LQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQNSANLGDKVKPIELAN 143

  Fly   223 AEFPLQDLNLQISGWDPTKSSQ-----TLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDT 282
            . .|.......||||....|.|     ||..:.||..:...|...||...:...||||.....||
  Rat   144 L-CPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADT 207

  Fly   283 CAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            |.|.||.|   ::.:||     |.||.|:|...|.....|||||||..::.|||..:
  Rat   208 CQGDSGGP---LVCNGV-----LQGITSWGSDPCGKPEKPGVYTKICRYTNWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 82/246 (33%)
Tryp_SPc 108..335 CDD:214473 79/243 (33%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 78/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.