DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Tpsb2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:277 Identity:78/277 - (28%)
Similarity:118/277 - (42%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL-------SLI--RYVLTAAHCVIGGYL 147
            |.||..|..       |...|..:::||.|.|.::...       |||  ::|||||||| |.::
  Rat    23 PVKQRVGIV-------GGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-GLHI 79

  Fly   148 TQNDLVLKSVRLGESTTDCITSESRCPHLD--VEVGQTTVH-QGFTSSGGTYRNDIALLRLQFPV 209
            ...:|....:|           |....:.|  :.|.:|.|| ..:|...|.   |||||.|:.||
  Rat    80 KSPELFRVQLR-----------EQYLYYADQLLTVNRTVVHPHYYTVEDGA---DIALLELENPV 130

  Fly   210 RYTKKIQPICLLDAE--FPLQDLNLQISGWDPTKSSQTL--------ITSTVKERNPADCLNRY- 263
            ..:..|.|..|..|.  || ...:..::||....|.:.|        :...:.|.:..|  .:| 
  Rat   131 NVSTHIHPTSLPPASETFP-SGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCD--RKYH 192

  Fly   264 ---------PSFRSASQVCAGGQRKGDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCYS 318
                     |..:. ..:|||..| .|:|.|.||.| |..:.|:.:.     ||:.|:|:. |..
  Rat   193 TGLYTGDDVPIVQD-GMLCAGNTR-SDSCQGDSGGPLVCKVKGTWLQ-----AGVVSWGEG-CAE 249

  Fly   319 AGIPGVYTKIGHFSEWI 335
            |..||:||::.::.:||
  Rat   250 ANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 74/261 (28%)
Tryp_SPc 108..335 CDD:214473 72/259 (28%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 74/270 (27%)
Tryp_SPc 30..266 CDD:214473 72/268 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.