DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and F10

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:363 Identity:92/363 - (25%)
Similarity:144/363 - (39%) Gaps:92/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCQK-------DEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPE 86
            ||.|       .:.|   :|.:|.     |.|.|...:   |.|...|:.:..|         |:
  Rat   150 SCAKGYFLGNDGKSC---LSTAPF-----PCGKTNKGR---AKRSVALNTSNSE---------PD 194

  Fly    87 LGDVLPNKQ------------TCGQTTP------VFRDRGAENAELNEYPWMVLLLYENRL---- 129
            ..|::|:..            ...:|.|      |.|..|.:..:..|.||..||..:...    
  Rat   195 PEDLMPDADILYPTESPSELLNLNKTEPEANSDDVIRIVGGQECKRGECPWQALLFSDEETDGFC 259

  Fly   130 --SLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFT 190
              :::.  |:||||||:       :......||:|    |..|.:.....:..||.....|..|.
  Rat   260 GGTILNEFYILTAAHCL-------HQAKRFKVRVG----DLNTEQEDGGEMVHEVDMIIKHNKFQ 313

  Fly   191 SSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ----ISGWDPT--KSSQTLITS 249
            ..  ||..|||:|||:.|:.:.:.:.|.||...::....|..|    :||:..|  |..|:.:..
  Rat   314 RD--TYDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGRQSKVLK 376

  Fly   250 TVK----ERNPADCLNRYPSFRSASQ--VCAG-GQRKGDTCAGISGSPVMGIMGSGVDEFVFLAG 307
            .::    :||..    |..:..|.:|  .||| ..::.|.|.|.||.|.:    :...:..|:.|
  Rat   377 MMEVPYVDRNTC----RLSTSFSITQNMFCAGYDAKQEDACQGDSGGPHV----TRFKDTYFVTG 433

  Fly   308 IASYGQQYCYSAGIPGVYTKIGHFSEWI----KANLAP 341
            |.|:|:. |...|..|:|||:..|.:||    ||.:.|
  Rat   434 IVSWGEG-CARKGKYGIYTKVTAFLKWIDRSMKARVGP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 10/48 (21%)
Tryp_SPc 108..338 CDD:238113 70/254 (28%)
Tryp_SPc 108..335 CDD:214473 67/247 (27%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372 3/13 (23%)
Tryp_SPc 232..462 CDD:238113 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.