DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Habp2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:369 Identity:105/369 - (28%)
Similarity:151/369 - (40%) Gaps:83/369 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KCTRLVSCSPLM----NILRPRG----MTQAEKDVFAHRQCGLDPNG-HELLHMVYV-------- 82
            |.:|.|:.:|.:    ::|....    |..||....|......:|:| |:....|.|        
  Rat   203 KVSRTVNQNPCLYWNSHLLLQENYNMFMEDAETHGIADHNFCRNPDGDHKPWCFVKVNSEKVKWE 267

  Fly    83 -C----CPE------LGDV------LPNKQTCGQTT----PVFRDRGAENAELNEYPWMVLLLYE 126
             |    |||      ||.:      ||...:||:|.    .|.|..|...:...::||.|.|...
  Rat   268 YCNVEVCPESDAANPLGSLQEPVMELPGFDSCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTS 332

  Fly   127 NRL------------SLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLD 177
            ..|            |||.  :|||||||        .|:..|.:::.....|...:||......
  Rat   333 LPLTTSMPQGHFCGGSLIHPCWVLTAAHC--------TDMSTKHLKVVLGDQDLKKTESHEQTFR 389

  Fly   178 VEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV-----RYTKKIQPICLLDAEFPLQDLNLQISGW 237
            ||  :...:..:........||||||:|: ||     ..:|.::.:||....|| ......||||
  Rat   390 VE--KILKYSQYNERDEIPHNDIALLKLK-PVGGHCALESKYVKTVCLPSDPFP-SGTECHISGW 450

  Fly   238 DPTKS---SQTLITSTVKERNPADCLNR--YPSFRSASQVCAGGQRK--GDTCAGISGSPVMGIM 295
            ..|::   |:.|:.:.||....|.|.:|  |......|.:|||..:|  .|||.|.||.|    :
  Rat   451 GVTETGEGSRQLLDAKVKLIANALCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGP----L 511

  Fly   296 GSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            ....|...::.||.|:||: |...  |||||::..|..|||..:
  Rat   512 TCEKDGTYYVYGIVSWGQE-CGKK--PGVYTQVTKFLNWIKTTM 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 15/70 (21%)
Tryp_SPc 108..338 CDD:238113 78/255 (31%)
Tryp_SPc 108..335 CDD:214473 75/252 (30%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056 15/71 (21%)
Tryp_SPc 312..551 CDD:238113 78/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.