DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Tmprss15

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:313 Identity:88/313 - (28%)
Similarity:131/313 - (41%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PNGHELLHMVYVCCPELGDVLP-NKQTCGQ---TTPVF-RDRGAENAELNEYPWMVLLLYENR-- 128
            |||..:|.....|..:...:|. |.::||:   |..|. :..|..:.:...:||:|.|.|.:|  
  Rat   749 PNGSLILTPSLQCSQDSLILLQCNHKSCGEKMVTQKVGPKIVGGSDTQAGAWPWVVALYYRDRSG 813

  Fly   129 ------LSLIR--YVLTAAHC-------------VIGGYLTQNDLVLKSVRLGESTTDCITSESR 172
                  .||:.  ::::||||             |:|.::..|   |.|.::.....|.|...  
  Rat   814 DRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSN---LTSPQVVRRVVDRIVIN-- 873

  Fly   173 CPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNL----- 232
             ||.|..               ...||||::.|:|.|.||..||||||     |.::...     
  Rat   874 -PHYDKR---------------RKVNDIAMMHLEFKVNYTDYIQPICL-----PEENQTFTPGRM 917

  Fly   233 -QISGWDPTKSSQTLITSTVKERNPAD--------CLNRYPSFR-SASQVCAGGQRKG-DTCAGI 286
             .|:||...|.:.......:||   ||        |..:.|.:. :.|.:|||.:..| |:|.|.
  Rat   918 CSIAGWGYNKINAGSTVDVLKE---ADVPLVSNEKCQQQLPEYDITESMLCAGYEEGGTDSCQGD 979

  Fly   287 SGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            ||.|:|    ...:...||.|:.|:|.| |.....||||.::..|.|||.:.|
  Rat   980 SGGPLM----CQENNRWFLVGVTSFGVQ-CALPNHPGVYARVSQFIEWIHSFL 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 4/12 (33%)
Tryp_SPc 108..338 CDD:238113 76/268 (28%)
Tryp_SPc 108..335 CDD:214473 74/265 (28%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 76/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.