DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:296 Identity:86/296 - (29%)
Similarity:120/296 - (40%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AHRQ-CGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYE 126
            ||.: ||..|               |.|||...:..|.|          .|:...:||:|.|..:
Human    59 AHAED
CGTAP---------------LKDVLQGSRIIGGT----------EAQAGAWPWVVSLQIK 98

  Fly   127 NRLSLI----------RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHL-DVEV 180
            ....|:          |:|||||||.    ...:|.::.:..:|.:..     ..|.||. .:::
Human    99 YGRVLVHVCGGTLVRERWVLTAAHCT----KDASDPLMWTAVIGTNNI-----HGRYPHTKKIKI 154

  Fly   181 GQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ--ISGWDPTK-- 241
            ....:|..|...  :|.|||||..|:..|||...||||||....|.:.|.|.:  ||||..||  
Human   155 KAIIIHPNFILE--SYVNDIALFHLKKAVRYNDYIQPICLPFDVFQILDGNTKCFISGWGRTKEE 217

  Fly   242 SSQTLITSTVK----ERNPADCLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDE 301
            .:.|.|....:    .|...:....|......:..|||.:... |||.|.||.|:|..:    .|
Human   218 GNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTCRGDSGGPLMCYL----PE 278

  Fly   302 F--VFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            :  .|:.||.|||.. |...|.||||.....:.:|:
Human   279 YKRFFVMGITSYGHG-CGRRGFPGVYIGPSFYQKWL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 5/21 (24%)
Tryp_SPc 108..338 CDD:238113 75/250 (30%)
Tryp_SPc 108..335 CDD:214473 74/248 (30%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 2/3 (67%)
Tryp_SPc 78..316 CDD:238113 77/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.