DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG18420

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:272 Identity:82/272 - (30%)
Similarity:120/272 - (44%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PELGDVLPNKQTCGQTTPVFRDRGAENAEL---NEYPWMVLL-------LYENRLSLIRYVLTAA 139
            |.||........||..:|:.......|.::   |..|||..|       :....|...|.|||||
  Fly    19 PLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAA 83

  Fly   140 HCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLR 204
            ||.|     .|..::  |||||....  ....|..|   :|.:|..|:.:..:  |:.|||||||
  Fly    84 HCFI-----PNTTIV--VRLGEYNRK--LKGYREEH---QVNRTFQHRFYDPN--THANDIALLR 134

  Fly   205 LQFPVRYTKKIQPICLL-DAEFPLQDLNLQI---SGWDPTKS---SQTLITSTVKERNPADCLNR 262
            |...|.|...|:|||:: ||.:.....::::   :||..|:|   |..|.|..:..:....|   
  Fly   135 LVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC--- 196

  Fly   263 YPSFRS--ASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFL-AGIASYGQQYCYSAGIPGV 324
              :|.|  ::|.|||.. ..:.|.|.:|.|| |.|....:.|.|: .|||...:: |..   |.|
  Fly   197 --AFGSVLSNQFCAGNW-NSNLCIGDTGGPV-GAMVRYRNAFRFVQVGIAITNKR-CQR---PSV 253

  Fly   325 YTKIGHFSEWIK 336
            :|.:....|:|:
  Fly   254 FTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 76/249 (31%)
Tryp_SPc 108..335 CDD:214473 75/246 (30%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 75/246 (30%)
Tryp_SPc 43..267 CDD:238113 76/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.