DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG33459

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:270 Identity:91/270 - (33%)
Similarity:125/270 - (46%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL------SLI--RYVLTAAHCVIGGYLT 148
            ||   |||.....|..|..:|.|...|||..|  .|.|      |||  .:||||||||:.   |
  Fly    27 PN---CGQIPFRMRIFGGMDAGLVSTPWMAFL--HNHLQFLCGGSLITSEFVLTAAHCVMP---T 83

  Fly   149 QNDLVLKSVRLGE----STTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209
            ..:|   :|||||    ...|.|..:.|  |.:..|.:...|..:.|...   .|||||:|...|
  Fly    84 PKNL---TVRLGEYDWTRQMDSINPKHR--HREYMVTRIYTHPSYRSIAA---YDIALLKLNQTV 140

  Fly   210 RYTKKIQPICL-LDAEF--------PLQDLNLQISGWDPTKS---SQTLITSTVKERNPADCLNR 262
            .||..|:|||| |...|        .::|..|  :||..||:   ||.|.::.:.:.:...|.:|
  Fly   141 EYTVAIRPICLVLPENFHEWYWLVDSVEDFTL--TGWGATKTEPVSQVLQSANLTQIDRGTCHDR 203

  Fly   263 YPSFRSASQVCAGGQRKGDTCAGISGSPV-MGIMGSGVDEFVFL-AGIASYGQQYCYSAGIPGVY 325
            |......:.:|||.. |...|.|.||||: |.::.:  ..::.. .||.|.|.:.|  .|:. |:
  Fly   204 YGHSVDHTHICAGSS-KSFACVGDSGSPLAMKVVHN--RRYIHAQVGIVSRGPKNC--DGVT-VF 262

  Fly   326 TKIGHFSEWI 335
            |.:..|:|||
  Fly   263 TNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 85/254 (33%)
Tryp_SPc 108..335 CDD:214473 83/252 (33%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 84/255 (33%)
Tryp_SPc 38..272 CDD:238113 83/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.