DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG33462

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:129/282 - (45%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLHMVYVCC---PELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLL----YENRLSLIR 133
            ::.:..:||   ...|..:..::.||  .|......:.||:|.:.|||..|.    :....:||.
  Fly     5 IIGIAVICCLWRRVQGFQMLLEEDCG--IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLIN 67

  Fly   134 --YVLTAAHCVIGGYLTQNDLVLKSVRLGESTT----DCITSESRCPHLDVEVGQTTVHQGFTSS 192
              :||||||||      .:||:: :|||||..|    ||.....:.|..:..|.....|:.:.::
  Fly    68 HLFVLTAAHCV------PDDLLI-TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAN 125

  Fly   193 GGTYRNDIALLRLQFPVRYTKKIQPICLLDA---EFPLQDLN-LQISGWDPT---KSSQTLITST 250
            ..|  |||.:|||...|.|...|:|||:..:   :.|:..|. ...:.|..|   .:|:.|.|..
  Fly   126 DQT--NDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMN 188

  Fly   251 VKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQ 314
            :..:....|...|....:..|:|| |......|:..||:| :..:..:|.|.:|.| ||||..:.
  Fly   189 IDRQPKETCSEIYGWNMTFEQICA-GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQL-GIASRVKG 251

  Fly   315 YCYSAGIPGVYTKIGHFSEWIK 336
            .|.::||   ...:..:::|||
  Fly   252 QCQNSGI---LMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 0/7 (0%)
Tryp_SPc 108..338 CDD:238113 74/247 (30%)
Tryp_SPc 108..335 CDD:214473 71/244 (29%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 71/237 (30%)
Tryp_SPc 48..269 CDD:214473 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.