DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Sp212

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:110/284 - (38%) Gaps:81/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GQTTPVFRDRGAENAELNEYPWMV--------LLLYENRLSLI--RYVLTAAHCVIGGYLTQNDL 152
            |.||| |..||.|... .:|||:.        .|.::.|.|||  ..|::|||||  ..:|::.:
  Fly   271 GSTTP-FIVRGNEFPR-GQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCV--HRMTEDRV 331

  Fly   153 VLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRN------------------D 199
            |   |.||....|                      .:...|...||                  |
  Fly   332 V---VGLGRYDLD----------------------DYGEDGAEMRNVMRLLWHPDYNTRSYSDAD 371

  Fly   200 IALLRLQFPVRYTKKIQPICL--LDAEFPLQDLNLQISGWDPTK-SSQTLITSTVKER--NPADC 259
            |||:.::.||.:...|.|||:  ::|...:..... |:||...: ||:|.....|:..  :|..|
  Fly   372 IALITIERPVTFNDIIAPICMWTVEASRTVSTTGF-IAGWGRDEDSSRTQYPRVVEAEIASPTVC 435

  Fly   260 LNRY-PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPG 323
            .:.: .:..:...:|||.:.....|.|.||.   |:|....|.:: |.||.|.|::     |..|
  Fly   436 ASTWRGTMVTERSLCAGNRDGSGPCVGDSGG---GLMVKQGDRWL-LRGIVSAGER-----GPAG 491

  Fly   324 --------VYTKIGHFSEWIKANL 339
                    :|..:.....||..|:
  Fly   492 TCQLNQYVLYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/271 (24%)
Tryp_SPc 108..335 CDD:214473 63/268 (24%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 66/274 (24%)
Tryp_SPc 277..511 CDD:214473 64/271 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.