DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Prss45

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:327 Identity:87/327 - (26%)
Similarity:133/327 - (40%) Gaps:88/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GLDPNGHELLHMVYVCC---------PELG-DVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVL 122
            |||.....|...:.:|.         |.|| :....:..||  ||.:.|...|:   :.:||...
Mouse     7 GLDAGPGSLRRWILICFAALLLLPPRPNLGYNENYTEPVCG--TPWWPDNLEES---HHWPWEAS 66

  Fly   123 LLYENRL----SLI--RYVLTAAHCVIGG--YLTQNDLVLKSVRLGESTTDCITSESRCPH---- 175
            |..|::.    :||  .:|::||||:.|.  |         ||.||.||..        |:    
Mouse    67 LQIEDKHVCGGALIDRSWVVSAAHCIQGNKEY---------SVMLGSSTLH--------PNGSSW 114

  Fly   176 -LDVEVGQTTVHQGFTSSGGTY-RNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ----- 233
             |.:.||...:|..:.  |..: |:|||||.|:.||.:.|.:|||||     |..:.|.:     
Mouse   115 TLKIPVGDIIIHPKYW--GRNFIRSDIALLCLETPVTFNKYVQPICL-----PEHNFNFKVGTKC 172

  Fly   234 -ISGWDPTK--SSQTLITS---------TVKERNPADCLNR---YPS---FRSASQVCAGGQRKG 280
             ::||...|  ||..|..:         .:..:|.....::   ||.   ....:.:|.....: 
Mouse   173 WVTGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGE- 236

  Fly   281 DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK------ANL 339
            |.|.|..|.|    :...:|....|||:.|: ::.|.:.....|||:|..::.|||      |.|
Mouse   237 DLCYGDPGGP----LACEIDGRWILAGVFSW-EKACATVPNLSVYTRITKYTIWIKDQVSHGAQL 296

  Fly   340 AP 341
            .|
Mouse   297 GP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 4/15 (27%)
Tryp_SPc 108..338 CDD:238113 71/272 (26%)
Tryp_SPc 108..335 CDD:214473 68/263 (26%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 70/259 (27%)
Tryp_SPc 59..286 CDD:214473 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.