DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Proc

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:318 Identity:98/318 - (30%)
Similarity:135/318 - (42%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RQCGLDPNGHELL--HM-----VYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAEL-------- 114
            |:|...| |:||.  ||     |...|.:|.     |:|..:.....||...|:.||        
  Rat   196 RRCACAP-GYELADDHMHC
RPTVNFPCGKLW-----KRTDKKRKNFKRDIDPEDEELELGPRIVN 254

  Fly   115 ------NEYPWMVLLLYENR-------LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDC 166
                  .:.||..:||...:       |....:|||||||:      ::...| :|||||     
  Rat   255 GTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCL------ESSKKL-TVRLGE----- 307

  Fly   167 ITSESRCP-HLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL----LDAEFP 226
            .....|.| .||:::.:..||..:|.|...  ||||||||..|...:|.|.||||    |..|..
  Rat   308 YDLRRRDPWELDLDIKEVLVHPNYTRSNSD--NDIALLRLSQPATLSKTIVPICLPNSGLAQELS 370

  Fly   227 LQDLNLQISGW----DPTKSSQ-------TLITSTVKERNPADCLNRYPSFRSASQVCAG--GQR 278
            .......::||    |..|..:       |.|...:..||  ||:....:..|.:.:|||  |..
  Rat   371 QAGQETVVTGWGYQSDKVKDGRRNRTFILTFIRIPLAARN--DCMQVMNNVVSENMLCAGIIGDT 433

  Fly   279 KGDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            : |.|.|.||.| |:...|:.     ||.|:.|:|:. |......|||||:|.:.:||
  Rat   434 R-DACDGDSGGPMVVFFRGTW-----FLVGLVSWGEG-CGHLNNYGVYTKVGSYLKWI 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/25 (36%)
Tryp_SPc 108..338 CDD:238113 83/268 (31%)
Tryp_SPc 108..335 CDD:214473 81/266 (30%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:405372 8/17 (47%)
Tryp_SPc 252..486 CDD:238113 80/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.